PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv1_012590_kwxx.t2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family MIKC_MADS
Protein Properties Length: 189aa    MW: 21538.2 Da    PI: 7.8873
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv1_012590_kwxx.t2genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF84.75.4e-27958150
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                        krien   rqvtf+kRr+g+lKKA+ELSvLCda+v v+ifs++gklye +
  Bv1_012590_kwxx.t2  9 KRIENPVHRQVTFCKRRTGLLKKAKELSVLCDADVGVVIFSPQGKLYELA 58
                        79*********************************************965 PP

2K-box35.35e-13921621686
               K-box  16 slqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkeke 86 
                         +++ e++ +  ei+ L++ +  +lG + + +++ eL+ +e++Le+ + +iR++K+++++++i+ l++k  e
  Bv1_012590_kwxx.t2  92 ESKDEVNMMTHEIKLLEKGLWSILGGGEGAMTMDELHVMEKHLESWICQIRTTKMNIMFQEIQALKNKIGE 162
                         6789**************************************************************99765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.5E-36160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.913161IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.5E-29174IPR002100Transcription factor, MADS-box
CDDcd002651.16E-40276No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-27323IPR002100Transcription factor, MADS-box
PfamPF003195.0E-251056IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-273859IPR002100Transcription factor, MADS-box
PROSITE profilePS512978.58790178IPR002487Transcription factor, K-box
PfamPF014869.3E-1393160IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MARGKVQLKR IENPVHRQVT FCKRRTGLLK KAKELSVLCD ADVGVVIFSP QGKLYELATK  60
GTMQGLIERY MKCTNGFHVA EPAAAIEKCM LESKDEVNMM THEIKLLEKG LWSILGGGEG  120
AMTMDELHVM EKHLESWICQ IRTTKMNIMF QEIQALKNKI GEQEGFYSFE QLTTNTPYAL  180
TIPSEIYQY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010683240.11e-140PREDICTED: agamous-like MADS-box protein AGL12 isoform X2
SwissprotQ388411e-73AGL12_ARATH; Agamous-like MADS-box protein AGL12
TrEMBLA0A0J8FUN51e-140A0A0J8FUN5_BETVU; Uncharacterized protein
STRINGVIT_18s0041g02140.t011e-77(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.16e-75AGAMOUS-like 12